top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|204228082|204241814|—|6|circRNA|PLEKHA6|ENST00000272203.7|21,20,19,18,17,16

PLEKHA6

Open Reading Frame (ORF)

LRPGDRGLPQGPHAVCPRQTMNKARKTPTRHCPWTPPETSALCPPGKR

Peptide

GLPQGPHAVCPRQTMNK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page