top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|200581200|200603955|—|12|circRNA|KIF14|ENST00000614960.4|19,18,17,16,15,14,13,12,11,10,9,8

KIF14

Open Reading Frame (ORF)

MKLSMMIQEANAISSKLKTYYVFGRQNLWKGKNTITE

Peptide

TYYVFGRQNLWK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page