top of page

CircRNA

Gene

chr1|197172159|197191899|-|8|circRNA|ZBTB41|ENST00000367405.4|9,8,7,6,5,4,3,2

ZBTB41

CircRNA UID

circZBTB41(9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

MFVRKFLKANQVWKCIFERIQENMRATPVFTQVRSPLSVIFVTSAIQQSLT

Peptide

CIFERIQENMR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page