top of page

CircRNA

Gene

chr1|19176591|19187540|—|9|circRNA|UBR4|NM_020765|20,19,18,17,16,15,14,13,12

UBR4

Open Reading Frame (ORF)

LLSPPFGWASGSQDSNSRRATTPLYHGFKEVEENWSKHFSSGIRDLGYSQ

Peptide

EVEENWSKHFSSGIR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page