top of page

CircRNA

Gene

chr1|19124540|19139220|-|7|circRNA|UBR4|NM_020765|65,64,63,62,61,60,59

UBR4

CircRNA UID

circUBR4(65,64,63,62,61,60,59)

Open Reading Frame (ORF)

LTPILESHLLSLTTRGFTFSPSSSLRRRGQYSSDRWFYPSDLSC

Peptide

GFTFSPSSSLRR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page