top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|186318446|186341389|—|21|circRNA|TPR|ENST00000367478.8|48,47,46,45,44,43,42,41,40,39,38,37,36,35,34,33,32,31,30,29,28

TPR

Open Reading Frame (ORF)

LALYLQQMKQQQVMMEMKYLWRQNLKGNCKNNGSA

Peptide

LALYLQQMKQQQVMMEMK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page