top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|185124943|185137796|—|3|circRNA|TRMT1L|NM_030934|12,11,10

TRMT1L

Open Reading Frame (ORF)

LNQSVRLKVSFQFMHLQMSTSKSCSPMQQRHRSTVCSGSGTFCVGSCESFEGTYFSR

Peptide

LKVSFQFMHLQMSTSK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page