top of page

CircRNA

Gene

chr1|185091578|185098344|+|3|circRNA|RNF2|ENST00000367510.7|3,4,5

RNF2

CircRNA UID

circRNF2(3,4,5)

Open Reading Frame (ORF)

LKMVVEQKIMVTVHTAVMHPHIAIRKQALVTNGPKHLMILG

Peptide

KQALVTNGPK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page