top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|179990506|180014505|+|7|circRNA|CEP350|ENST00000367607.7|4,5,6,7,8,9,10

CEP350

Open Reading Frame (ORF)

MKIPLLFPKGATMTQMRYDSTLLGSRRKGRESKMKRRRLKRRLQNRKTNDYKSSTGSRRKPLLK

Peptide

YDSTLLGSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page