top of page

CircRNA

Gene

chr1|179852631|179865854|—|2|circRNA|TOR1AIP2|NM_001199260|4,3

TOR1AIP2

Open Reading Frame (ORF)

LINVLPRQTSLDPRSRGLCQVFLTPLHCYKVPRP

Peptide

QTSLDPRSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page