top of page

CircRNA

Gene

chr1|173980808|173984619|-|4|circRNA|RC3H1|NM_001300850|5,4,3,2

RC3H1

Open Reading Frame (ORF)

LLWKQAYELHRTSGPLCFMETSLTNLICSPLLTRSLSSSLLLCVVGLKTQSIMRKPRNV

Peptide

LLWKQAYELHR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page