top of page

CircRNA

Gene

chr1|169862612|169888890|-|9|circRNA|SCYL3|ENST00000367771.10|10,9,8,7,6,5,4,3,2

SCYL3

CircRNA UID

circSCYL3(10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

LPHCIRDGIREQCFKELYTERTTIYLTLWTCCLSRCTARWQICFSFCV

Peptide

ELYTERTTIYLTLWTCCLSR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page