top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|168090563|168104894|-|3|circRNA|GPR161|NM_153832|6,5,4

GPR161

Open Reading Frame (ORF)

LRSWQVDSPWGTAAARGTLASAAPRTQSSSMLCPPHAEVH

Peptide

GTLASAAPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page