top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|16625774|16633346|-|8|circRNA|CROCCP2|TCONS_l2_00001041|9,8,7,6,5,4,3,2

CROCCP2

Open Reading Frame (ORF)

LAAGAASTGTRCSWEGSCPGGRPGNEHRPAAGREPGRASPGEAGPAGGAAAGQGAPREGPVPAADAKRPGQG

Peptide

ASPGEAGPAGGAAAGQGAPR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page