top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|16564806|16567351|—|4|circRNA|NBPF1|ENST00000430580.6|28,27,26,25

NBPF1

Open Reading Frame (ORF)

LKRRGRGRKEGEEDQRRKEGEGEEKKGKKIKTHHAPGSAGSCWMRKGLKSCRTHWIDVIQLLQVILN

Peptide

IKTHHAPGSAGSCWMR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page