top of page

CircRNA

Gene

chr1|16148377|16149047|-|1|circRNA|EPHA2|ENST00000358432.7|3

EPHA2

CircRNA UID

circEPHA2(3)

Open Reading Frame (ORF)

LATRTTGSAPTGCTEERLSVSSLSSSLLYVTATASLVAPAPARRLSTSTMPSRTWTTAPTSRSACSPRLTPLRPMRSPSAATSRHAT

Peptide

SPSAATSR

ORF Found in Long-Read

true

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page