top of page

CircRNA

Gene

chr1|156482436|156483430|—|2|circRNA|MEF2D|NM_005920|3,2

MEF2D

Open Reading Frame (ORF)

MSHTRAAPTPTSSRRLCRRYPADHELSTVPRPFMSTV

Peptide

AAPTPTSSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page