top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|156475107|156477202|-|2|circRNA|MEF2D|NM_001271629|8,7

MEF2D

Open Reading Frame (ORF)

MPSALGSPSLLIRSPPQWFLWQRRVYSARASPSLPCPLPTTQGMATSVLGLPLASSLWPMATA

Peptide

MPSALGSPSLLIR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page