top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|156136213|156137028|+|2|circRNA|LMNA|NM_001282625|10,11

LMNA

Open Reading Frame (ORF)

MGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTATPVPQPYLAAQPWPCFLSLIPDTGWGQRHQKAQTGVH

Peptide

HQKAQTGVH

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page