top of page

CircRNA

Gene

chr1|155925631|155927156|-|3|circRNA|KIAA0907|ENST00000368321.7|7,6,5

KIAA0907

CircRNA UID

circKIAA0907(7,6,5)

Open Reading Frame (ORF)

MLYPLLMSRRRWKVQAAPICSTFRLKQVPKSSCGAKVQAALSQHLAEKLLNLCIFTSGIVHYIFMFRARHGN

Peptide

MLYPLLMSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page