top of page

CircRNA

Gene

chr1|155813633|155853806|-|9|circRNA|GON4L|NM_001282858|10,9,8,7,6,5,4,3,2

GON4L

CircRNA UID

circGON4L(10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

MGPPPPPKPKQTRDSTFMEKLHAVDEELASSPVCMDSFQNGTKVGLLKCCPVRREELQ

Peptide

DSTFMEKLHAVDEELASSPVCMDSFQNGTK

ORF Found in Long-Read

false

Peptide Length

30

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC

NA

Potential Cryptic Translation

false

bottom of page