top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|155349326|155354630|—|4|circRNA|ASH1L|NM_018489|19,18,17,16

ASH1L

Open Reading Frame (ORF)

MLKVFRNAEELCVKASCILGPKLGEDSSKTGGSKAHQ

Peptide

ASCILGPKLGEDSSK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page