top of page

CircRNA

Gene

chr1|155343313|155346469|—|4|circRNA|ASH1L|NM_018489|24,23,22,21

ASH1L

Open Reading Frame (ORF)

LPLVTIISVPTKHTTLHPVGSIIMNYFGCHSMRSFPWRL

Peptide

HTTLHPVGSIIMNYFGCHSMRSFPWR

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

26

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page