top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|155338088|155342102|-|3|circRNA|ASH1L|NM_018489|27,26,25

ASH1L

Open Reading Frame (ORF)

MRYPAWRSQNGKGPLLTSVRVKKKQRKVVKNPSQPVPLRNDGITNGNDSTRSCSISLKKSLEKMGDPKE

Peptide

MRYPAWR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page