top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|155239615|155240077|—|2|circRNA|GBA|NM_000157|4,3

GBA

Open Reading Frame (ORF)

MLLLSTSLPCHPLPKICYLNRTSLKKVPAPASLKASATARWCVSAMPHTVTPLTPRPFLPLVPSAAMRVHAVGDGWS

Peptide

ASATARWCVSAMPHTVTPLTPRPFLPLVPSAAMR

ORF Found in Long-Read

false

Peptide Length

34

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

34

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page