top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|15518109|15518395|-|1|circRNA|CASP9|ENST00000546424.5|2

CASP9

Open Reading Frame (ORF)

LIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVAGRLWISAGSGQAADHRSGDSRESGSSFVHLLLRGHRPGHAGFVSAN

Peptide

ESGSSFVHLLLR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page