top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|154601040|154602626|-|1|circRNA|ADAR|NM_001193495|2

ADAR

Open Reading Frame (ORF)

LGKGRPPQHMICLGNLGLRRKKSIEFYTPWQRRASYRKRQEHPLCGKSRSPLRLGTSTAEW

Peptide

LGKGRPPQHMICLGNLGLR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page