top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|154234590|154251653|+|10|circRNA|UBAP2L|NM_001127320|5,6,7,8,9,10,11,12,13,14

UBAP2L

Open Reading Frame (ORF)

LGHCSLGQSLSFLIMSPPPPRAPLQARLQVACIPARPAFLGDGREEEGSLRPEGWWPDGIQ

Peptide

LGHCSLGQSLSFLIMSPPPPRAPLQAR

ORF Found in Long-Read

true

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page