top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|151423396|151442205|-|8|circRNA|POGZ|ENST00000358476.7|9,8,7,6,5,4,3,2

POGZ

Open Reading Frame (ORF)

MNHMKHHVELDQQNGEVDGHTICQHCYRQFSTPFQLQCHLENVHSPYESTTWRTPTCSWNVRRRSWSHGRKSVMSLRTL

Peptide

KSVMSLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page