top of page

CircRNA

Gene

chr1|149934190|149935359|-|4|circRNA|MTMR11|NM_181873|6,5,4,3

MTMR11

CircRNA UID

circMTMR11(6,5,4,3)

Open Reading Frame (ORF)

LAPENHQFLSWRQRKTGRLSGRSRQPEAGGSARSTRGST

Peptide

LAPENHQFLSWR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page