top of page

CircRNA

Gene

chr1|1256991|1267992|-|5|circRNA|UBE2J2|ENST00000450390.6|6,5,4,3,2

UBE2J2

Open Reading Frame (ORF)

LVCLHHPDWAPELHGGEGPHPGQYRDVGLHDEQHQQ

Peptide

DVGLHDEQHQQ

ORF Found in Long-Read

true

Peptide Length

11

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page