top of page

CircRNA

Gene

chr1|12362719|12385373|+|9|circRNA|VPS13D|NM_015378|51,52,53,54,55,56,57,58,59

VPS13D

CircRNA UID

circVPS13D(51,52,53,54,55,56,57,58,59)

Open Reading Frame (ORF)

LQKLKNPDTEQELEVLMSRKAEVDTLIPAWSSLPPVTC

Peptide

AEVDTLIPAWSSLPPVTC

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page