top of page

CircRNA

Gene

chr1|119953689|119955039|-|1|ciRNA|NOTCH2|ENST00000256646.6|13

NOTCH2

Open Reading Frame (ORF)

LIFFPLLKHSSALFCHSASVCSEVGPLQPTLEMSLIKHLQFLSPTDLCDVLVIF

Peptide

LIFFPLLK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page