top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|119953689|119955039|—|1|ciRNA|NOTCH2|ENST00000256646.6|13

NOTCH2

Open Reading Frame (ORF)

MKVEMRSVYPISSPSPVFHSMTQSYVYTSYSKKFCLLSVSSCPM

Peptide

SVYPISSPSPVFHSMTQSYVYTSYSKK

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page