top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|11803148|11803404|—|1|ciRNA|MTHFR|ENST00000376583.7|1

MTHFR

Open Reading Frame (ORF)

LSPRSMLQCRVGAALHARSLAAAEGKALSEAARTAIAEEHGATGRGQCHLFWPSSCVEIQRLRLEPATQVS

Peptide

VGAALHAR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page