top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|117402185|117405645|+|2|circRNA|MAN1A2|ENST00000356554.7|2,3

MAN1A2

Open Reading Frame (ORF)

MMKHAWDNYRTYGWGHNELRPIARKGHSPNIFGKRKNV

Peptide

GHSPNIFGKR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page