top of page

CircRNA

Gene

chr1|117091950|117092709|+|1|ciRNA|TTF2|ENST00000369466.8|17

TTF2

CircRNA UID

ciTTF2(17)

Open Reading Frame (ORF)

MLFRFFYFCFLVGWRKGGLFILLYFILILIIPMASRIVYFYCLFCFRLTV

Peptide

KGGLFILLYFILILIIPMASR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page