top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|116941714|116945092|+|2|circRNA|PTGFRN|NM_020440|2,3

PTGFRN

Open Reading Frame (ORF)

LHRRLRLAAAHAPGAAVGGAPRPGQAERPRPDPRGQVPPGPGVRAALPQWGRAPRHRGQRRLPPLSVPGSVCRPGLLQVYRQRVDRRAGQLAGNPRKGRGSCHRGDPAISSLPRACGESPHSDPGSSGGH

Peptide

GDPAISSLPR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page