top of page

CircRNA

Gene

chr1|113829591|113834439|-|4|circRNA|PTPN22|ENST00000359785.9|18,17,16,15

PTPN22

Open Reading Frame (ORF)

LEKVSQGVRRILTKCSQILILSCEGKNWNITGMGWNI

Peptide

LEKVSQGVR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page