top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|11199257|11199703|-|2|circRNA|MTOR|NM_004958|28,27

MTOR

Open Reading Frame (ORF)

MTMALFCWVRELPSAEHMPKHYTTKNWSSRKAPPLPF

Peptide

ELPSAEHMPK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page