top of page

CircRNA

Gene

chr1|110038682|110043856|+|8|circRNA|STRIP1|ENST00000369796.5|3,4,5,6,7,8,9,10

STRIP1

CircRNA UID

circSTRIP1(3,4,5,6,7,8,9,10)

Open Reading Frame (ORF)

LIKQDNLDAFNERDPYKADDSREEEEENDDDNSLEGETFPLERDEVMPPPLQHPQTDRLTCPKGLPWAPKVRALQLHGRARIPDESKML

Peptide

ALQLHGRAR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page