top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|109326991|109345878|—|6|circRNA|SORT1|NM_001205228|13,12,11,10,9,8

SORT1

Open Reading Frame (ORF)

MVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIN

Peptide

MLEGPHYYTILDSGGIIVAIEHSSRPINVIN

ORF Found in Long-Read

false

Peptide Length

31

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

30

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page