top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|109010915|109011718|—|1|circRNA|WDR47|ENST00000400794.7|5

WDR47

Open Reading Frame (ORF)

MIREFQTLETKLLQCHTPLLTSIIQGYKTSVEVSCLRIQNVTVFTKNPLSAGIYHARSCAMFTCSRRILSF

Peptide

IQNVTVFTKNPLSAGIYHAR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page