top of page

CircRNA

Gene

chr1|10365099|10365648|+|2|circRNA|KIF1B|NM_015074|40,41

KIF1B

Open Reading Frame (ORF)

LKAPSHLARAVAMIQETSKAWWTERKSWLPRYAEKEKKNLRYVSGICAGRRELSRLAAPWRQPHP

Peptide

AVAMIQETSKAWWTER

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page