top of page

CircRNA

Gene

chrM|9157|9304|1|147|0

ENSG00000198899

Open Reading Frame (ORF)

MTSGLAILRFHTSSKPLPARQHIMTHQSHAYHIVKPSP

Peptide

MTSGLAILR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

9

2

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

20 8 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page