top of page

CircRNA

Gene

chr9|35295695|35313989|3|39,77,91|0,15009,18203

UNC13B

Open Reading Frame (ORF)

LDPSSYQGSTPAAGAFEDPDSAVDDRDNERRCHNPPSPRSGAAKRPLPRSPGEFS

Peptide

SGAAKRPLPR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Junction

Peptide Length

Frame

Start Codon

10

3

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000116

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

0 0 0 0 31 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

TRUE

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page