top of page

CircRNA

Gene

chr9|131197792|131197926|1|134|0

NUP214

Open Reading Frame (ORF)

LSFGSLLMLARLVFHLEANRPIAQCPHLPHHQLQLPLPFQHHSPHCHLVAS

Peptide

LSFGSLLMLAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

11

2

TTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

22 12 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page