top of page

CircRNA

Gene

chr9|130888331|130888520|1|189|0

ENST00000343079

Open Reading Frame (ORF)

LLSRMCTPDKPAGLIRGESCAWHCSQWAPPAPARLEFHLSPTAQQSRSRSLEWSFTKL

Peptide

MCTPDKPAGLIRGESCAWHCSQWAPPAPAR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Junction

Junction

Peptide Length

Frame

Start Codon

30

3

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TGA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

34 57 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page