top of page

CircRNA

Gene

chr9|130458478|130466762|3|111,57,38|0,5632,8246

ASS1

Open Reading Frame (ORF)

LGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRTATSWAPLLPGPASPANKWKSPSGRGPSMCPTAPQERGTIRSGLSSAATHWPPR

Peptide

SPSGRGPSMCPTAPQER

ORF Found in Short-Read

Peptide Type

ORF Type

true

Alternative

Junction

Peptide Length

Frame

Start Codon

17

1

CTG

Stop Codon

Proteome Support

Number of Exon Blocks

TAA

PDC000109

2

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

50 2 0 0 0 0 0

isoCirc

Short Read Rescue Status

Differentially Expressed in mCRC

High Confidence Chimeric Support

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page