top of page

CircRNA

Gene

chr9|128694934|128695135|1|201|0

SET

Open Reading Frame (ORF)

MLVNANCPYSHRDTVYSLSPIYRERRKKARILCTTTQGPSTLQLPAERREQVFLFSHRARW

Peptide

REQVFLFSHR

ORF Found in Short-Read

Peptide Type

ORF Type

false

Alternative

Alternative

Peptide Length

Frame

Start Codon

10

3

ATG

Stop Codon

Proteome Support

Number of Exon Blocks

TAG

PDC000109

1

Peptide DNA Mapping to Exon Blocks

Long-Read Software Support

31 0 0

CIRI-long

Short Read Rescue Status

Differentially Expressed in mCRC

Novel in Long-Read

NA

CircRNA Exists in PepTransDB

Peptide Exists in PepTransDB

false

false

bottom of page